PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_E0978B1BC.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 125aa    MW: 14370.6 Da    PI: 8.7073
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_E0978B1BC.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.83.8e-251058250
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                           rien   rqvtf+kRr g+lKKA+ELSvLCda++ v++fs++gk+ye +
  Traes_2BL_E0978B1BC.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVMVFSPHGKVYELA 58
                           8*********************************************965 PP

2K-box23.22.8e-0977125451
                  K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeL 51 
                            ++g+s e++k e  qqe+  L++ei+ Lq+ +R + Ge d++ ++l+eL
  Traes_2BL_E0978B1BC.1  77 AHGESSEQNKPEVIQQEVLLLRQEIDLLQKGLRYMYGEnDINHMNLNEL 125
                            45677899999**************************978********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.67E-28174IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.931161IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-35160IPR002100Transcription factor, MADS-box
CDDcd002651.30E-38274No hitNo description
PRINTSPR004045.3E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.2E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-263859IPR002100Transcription factor, MADS-box
PfamPF014865.0E-781125IPR002487Transcription factor, K-box
PROSITE profilePS512977.8387125IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVMVFSP HGKVYELATN  60
GNMQGLIERY KGSNTEAHGE SSEQNKPEVI QQEVLLLRQE IDLLQKGLRY MYGENDINHM  120
NLNEL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2500310.0AK250031.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf65p11, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758882.15e-80PREDICTED: MADS-box transcription factor 26-like isoform X1
SwissprotA2YQK92e-52MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-52MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLW5BG965e-89W5BG96_WHEAT; Uncharacterized protein
TrEMBLW5BVZ77e-89W5BVZ7_WHEAT; Uncharacterized protein
STRINGBRADI5G11270.19e-79(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.19e-49AGAMOUS-like 12
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]